PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000818-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 379aa    MW: 42541.6 Da    PI: 6.6248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000818-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-1762109148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
    NNU_000818-RA  62 KGPWTPEEDIILVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 109
                      79******************************99************97 PP

2Myb_DNA-binding50.16.4e-16115160148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    NNU_000818-RA 115 RGNFTEQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 160
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.83957109IPR017930Myb domain
SuperFamilySSF466891.43E-3059156IPR009057Homeodomain-like
SMARTSM007172.0E-1461111IPR001005SANT/Myb domain
PfamPF002494.1E-1662109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2363116IPR009057Homeodomain-like
CDDcd001674.75E-1164109No hitNo description
PROSITE profilePS5129424.775110164IPR017930Myb domain
SMARTSM007176.5E-16114162IPR001005SANT/Myb domain
PfamPF002494.1E-15115160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-25117165IPR009057Homeodomain-like
CDDcd001671.11E-10117159No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
CLGRLSQQSN NKQAKINTTQ EKKIEESRID SLVGITKESW RQTHQRGGMG RPPCCDKIGV  60
KKGPWTPEED IILVSYIQEH GPGNWRAVPT NTGLLRCSKS CRLRWTNYLR PGIKRGNFTE  120
QEEKMIIHLQ ALLGNRWAAI ASYLPQRTDN DIKNYWNTHL KKKLKKLQTG FDGHTKDGFS  180
GSQTMLKGQW ERRLQTDIHM AKRALCEALS LEKPNSLCDL KPYDSYFSWM RPNQASTYAS  240
STENISRLLE GWMRNSSKSG GSTPETTQNS INMTVGTDST SSQGTTSACA ANHTDDLSPD  300
AFESLLDFDS STPDVSQSTS LDETANFAQE TSLLQDESKP KLEAQAPLSM LEKWLFDEGM  360
TQGQEDLIGI SLDETSELF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-256216427128MYB TRANSFORMING PROTEIN
1h89_C5e-256216458159MYB PROTO-ONCOGENE PROTEIN
1h88_C5e-256216458159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00235DAPTransfer from AT1G74650Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257368.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-125MYB06_ANTMA; Myb-related protein 306
TrEMBLF6H5T61e-159F6H5T6_VITVI; Putative uncharacterized protein
STRINGVIT_14s0108g00830.t011e-158(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74650.11e-106myb domain protein 31